Lineage for d1h1ic_ (1h1i C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070236Family b.82.1.5: Quercetin 2,3-dioxygenase-like [75035] (3 protein domains)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin
  6. 2070241Protein Quercetin 2,3-dioxygenase [75036] (1 species)
  7. 2070242Species Aspergillus japonicus [TaxId:34381] [75037] (5 PDB entries)
  8. 2070253Domain d1h1ic_: 1h1i C: [76471]
    complexed with cu, mpd, nag, que

Details for d1h1ic_

PDB Entry: 1h1i (more details), 1.75 Å

PDB Description: crystal structure of quercetin 2,3-dioxygenase anaerobically complexed with the substrate quercetn
PDB Compounds: (C:) quercetin 2,3-dioxygenase

SCOPe Domain Sequences for d1h1ic_:

Sequence, based on SEQRES records: (download)

>d1h1ic_ b.82.1.5 (C:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]}
sslivedapdhvrpyvirhysharavtvdtqlyrfyvtgpssgyaftlmgtnaphsdalg
vlphihqkhyenfycnkgsfqlwaqsgnetqqtrvlssgdygsvprnvthtfqiqdpdte
mtgvivpggfedlfyylgtnatdtthtpyipsssdsssttgpdsstistlqsfdvyaels
ftprtdtvngtapantvwhtganalastagdpyfiangwgpkylnsqygyqivapfvtat
qaqdtnytlstismsttpstvtvptwsfpgacafqvqegrvvvqigdyaatelgsgdvaf
ipggvefkyyseayfskvlfvssgsdgldqnlvnggeewssvsfpadw

Sequence, based on observed residues (ATOM records): (download)

>d1h1ic_ b.82.1.5 (C:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]}
sslivedapdhvrpyvirhysharavtvdtqlyrfyvtgpssgyaftlmgtnaphsdalg
vlphihqkhyenfycnkgsfqlwaqsgnetqqtrvlssgdygsvprnvthtfqiqdpdte
mtgvivpggfedlfyylgtnatdtthtpyipssttgpdsstistlqsfdvyaelsftprt
dtvngtapantvwhtganalastagdpyfiangwgpkylnsqygyqivapfvtatqaqdt
nytlstismsttpstvtvptwsfpgacafqvqegrvvvqigdyaatelgsgdvafipggv
efkyyseayfskvlfvssgsdgldqnlvnggeewssvsfpadw

SCOPe Domain Coordinates for d1h1ic_:

Click to download the PDB-style file with coordinates for d1h1ic_.
(The format of our PDB-style files is described here.)

Timeline for d1h1ic_: