SCOPe 2.06: Domain d1h1ha1: 1h1h A:1-133

Lineage for d1h1ha1 (1h1h A:1-133)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Eosinophil cationic protein (ECP), ribonuclease 3 [54090] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54091] (11 PDB entries)

8. Domain d1h1ha1: 1h1h A:1-133 [76468]
   Other proteins in same PDB: d1h1ha2
   complexed with a2p

Details for d1h1ha1

PDB Entry: 1h1h, 2 Å

PDB Description: crystal structure of eosinophil cationic protein in complex with 2', 5'-adp at 2.0 a resolution reveals the details of the ribonucleolytic active site

PDB Compounds: (A:) eosinophil cationic protein

SCOPe Domain Sequences for d1h1ha1:

Sequence; same for both SEQRES and ATOM records:

>d1h1ha1 d.5.1.1 (A:1-133) Eosinophil cationic protein (ECP), ribonuclease 3 {Human (Homo sapiens) [TaxId: 9606]}
rppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqsi
rcphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprdsp
rypvvpvhldtti

Timeline for d1h1ha1:

• d1h1ha1 first appeared in SCOP 1.63, called d1h1ha_
  
• d1h1ha1 was called d1h1ha_ in SCOPe 2.05
  
• d1h1ha1 appears in SCOPe 2.07
  
• d1h1ha1 appears in the current release, SCOPe 2.08