Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein Eosinophil cationic protein (ECP), ribonuclease 3 [54090] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54091] (11 PDB entries) |
Domain d1h1ha1: 1h1h A:1-133 [76468] Other proteins in same PDB: d1h1ha2 complexed with a2p |
PDB Entry: 1h1h (more details), 2 Å
SCOPe Domain Sequences for d1h1ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h1ha1 d.5.1.1 (A:1-133) Eosinophil cationic protein (ECP), ribonuclease 3 {Human (Homo sapiens) [TaxId: 9606]} rppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqsi rcphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprdsp rypvvpvhldtti
Timeline for d1h1ha1: