Lineage for d1h18b_ (1h18 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097778Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2097779Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2097780Family c.7.1.1: PFL-like [51999] (2 protein domains)
    Pfam PF02901; except the C-terminal ~100 residues covered by Pfam PF01228
  6. 2097791Protein Pyruvate formate-lyase, PFL [52000] (1 species)
  7. 2097792Species Escherichia coli [TaxId:562] [52001] (8 PDB entries)
  8. 2097804Domain d1h18b_: 1h18 B: [76465]
    complexed with dtl, na, pg4, pyr

Details for d1h18b_

PDB Entry: 1h18 (more details), 2.3 Å

PDB Description: pyruvate formate-lyase (e.coli) in complex with pyruvate
PDB Compounds: (B:) formate acetyltransferase 1

SCOPe Domain Sequences for d1h18b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h18b_ c.7.1.1 (B:) Pyruvate formate-lyase, PFL {Escherichia coli [TaxId: 562]}
selneklatawegftkgdwqnevnvrdfiqknytpyegdesflagateatttlwdkvmeg
vklenrthapvdfdtavastitshdagyinkqlekivglqteaplkralipfggikmieg
sckaynreldpmikkifteyrkthnqgvfdvytpdilrcrksgvltglpdaygrgriigd
yrrvalygidylmkdklaqftslqadlengvnleqtirlreeiaeqhralgqmkemaaky
gydisgpatnaqeaiqwtyfgylaavksqngaamsfgrtstfldvyierdlkagkiteqe
aqemvdhlvmklrmvrflrtpeydelfsgdpiwatesiggmgldgrtlvtknsfrflntl
ytmgpspepnmtilwseklplnfkkfaakvsidtsslqyenddlmrpdfnnddyaiaccv
spmivgkqmqffgaranlaktmlyainggvdeklkmqvgpksepikgdvlnydevmermd
hfmdwlakqyitalniihymhdkysyeaslmalhdrdvirtmacgiaglsvaadslsaik
yakvkpirdedglaidfeiegeypqfgnndprvddlavdlverfmkkiqklhtyrdaipt
qsvltitsnvvygkktgntpdgrragapfgpganpmhgrdqkgavasltsvaklpfayak
dgisytfsivpnalgkddevrktnlaglmdgyfhheasieggqhlnvnvmnremlldame
npekypqltirvsgyavrfnsltkeqqqdvitrtftqsm

SCOPe Domain Coordinates for d1h18b_:

Click to download the PDB-style file with coordinates for d1h18b_.
(The format of our PDB-style files is described here.)

Timeline for d1h18b_: