Lineage for d1h15e1 (1h15 E:93-190)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654956Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 654964Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (38 PDB entries)
    probably orthologous to the mouse I-E group
  8. 655014Domain d1h15e1: 1h15 E:93-190 [76460]
    Other proteins in same PDB: d1h15a1, d1h15a2, d1h15b2, d1h15d1, d1h15d2, d1h15e2
    complexed with nag, ndg

Details for d1h15e1

PDB Entry: 1h15 (more details), 3.1 Å

PDB Description: x-ray crystal structure of hla-dra1*0101/drb5*0101 complexed with a peptide from epstein barr virus dna polymerase
PDB Compounds: (E:) hla class II histocompatibility antigen, dr beta 1 chain

SCOP Domain Sequences for d1h15e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h15e1 b.1.1.2 (E:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypartqtlqhhnllvcsvngfypgsievrwfrnsqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

SCOP Domain Coordinates for d1h15e1:

Click to download the PDB-style file with coordinates for d1h15e1.
(The format of our PDB-style files is described here.)

Timeline for d1h15e1: