Lineage for d1h15d2 (1h15 D:3-81)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2183231Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2183241Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
    Uniprot P01903 28-207
  8. 2183268Domain d1h15d2: 1h15 D:3-81 [76459]
    Other proteins in same PDB: d1h15a1, d1h15b1, d1h15b2, d1h15d1, d1h15e1, d1h15e2
    complexed with a peptide from epstein barr virus dna polymerase, chains C and H
    protein/DNA complex; complexed with nag

Details for d1h15d2

PDB Entry: 1h15 (more details), 3.1 Å

PDB Description: x-ray crystal structure of hla-dra1*0101/drb5*0101 complexed with a peptide from epstein barr virus dna polymerase
PDB Compounds: (D:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1h15d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h15d2 d.19.1.1 (D:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOPe Domain Coordinates for d1h15d2:

Click to download the PDB-style file with coordinates for d1h15d2.
(The format of our PDB-style files is described here.)

Timeline for d1h15d2: