SCOPe 2.02: Domain d1h15d2: 1h15 D:3-81

Lineage for d1h15d2 (1h15 D:3-81)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (15 PDB entries)
   Uniprot P01903 28-207

8. Domain d1h15d2: 1h15 D:3-81 [76459]
   Other proteins in same PDB: d1h15a1, d1h15b1, d1h15b2, d1h15d1, d1h15e1, d1h15e2
   complexed with a peptide from epstein barr virus dna polymerase, chains C and H
   protein/DNA complex; complexed with nag

Details for d1h15d2

PDB Entry: 1h15, 3.1 Å

PDB Description: x-ray crystal structure of hla-dra1*0101/drb5*0101 complexed with a peptide from epstein barr virus dna polymerase

PDB Compounds: (D:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1h15d2:

Sequence; same for both SEQRES and ATOM records:

>d1h15d2 d.19.1.1 (D:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

Timeline for d1h15d2:

• d1h15d2 first appeared in SCOP 1.63
  
• d1h15d2 appears in SCOPe 2.01
  
• d1h15d2 appears in SCOPe 2.03
  
• d1h15d2 appears in the current release, SCOPe 2.08