Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries) Uniprot P01903 28-207 probably orthologous to the mouse I-E group |
Domain d1h15d1: 1h15 D:82-182 [76458] Other proteins in same PDB: d1h15a2, d1h15b1, d1h15b2, d1h15d2, d1h15e1, d1h15e2 protein/DNA complex; complexed with nag |
PDB Entry: 1h15 (more details), 3.1 Å
SCOPe Domain Sequences for d1h15d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h15d1 b.1.1.2 (D:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
Timeline for d1h15d1: