SCOP 1.63: Domain d1h15d1: 1h15 D:82-182

Lineage for d1h15d1 (1h15 D:82-182)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (11 PDB entries)

8. Domain d1h15d1: 1h15 D:82-182 [76458]
   Other proteins in same PDB: d1h15a2, d1h15b2, d1h15d2, d1h15e2

Details for d1h15d1

PDB Entry: 1h15, 3.1 Å

PDB Description: x-ray crystal structure of hla-dra1*0101/drb5*0101 complexed with a peptide from epstein barr virus dna polymerase.

PDB Compounds: (D:)

SCOP Domain Sequences for d1h15d1:

Sequence; same for both SEQRES and ATOM records:

>d1h15d1 b.1.1.2 (D:82-182) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

Timeline for d1h15d1:

• d1h15d1 appears in SCOP 1.65
  
• d1h15d1 appears in the current release, SCOPe 2.07