SCOP 1.63: Domain d1h0ya_: 1h0y A:

Lineage for d1h0ya_ (1h0y A:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.68: IF3-like [55199] (7 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.6: DNA-binding protein Sso10b (AlbA) [82704] (1 family)

5. Family d.68.6.1: DNA-binding protein Sso10b (AlbA) [82705] (1 protein)

6. Protein DNA-binding protein Sso10b (AlbA) [82706] (1 species)
   an archaeal chromatin protein modulated by acetylation

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [82707] (2 PDB entries)

8. Domain d1h0ya_: 1h0y A: [76453]
   complexed with so4

Details for d1h0ya_

PDB Entry: 1h0y, 2.8 Å

PDB Description: structure of alba: an archaeal chromatin protein modulated by acetylation

SCOP Domain Sequences for d1h0ya_:

Sequence; same for both SEQRES and ATOM records:

>d1h0ya_ d.68.6.1 (A:) DNA-binding protein Sso10b (AlbA) {Archaeon Sulfolobus solfataricus}
snvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkieik
eirvgsqvvtsqdgrqsrvstieiairkk

Timeline for d1h0ya_:

• d1h0ya_ is new in SCOP 1.63
  
• d1h0ya_ appears in SCOP 1.65
  
• d1h0ya_ appears in the current release, SCOPe 2.08