Lineage for d1h0ya_ (1h0y A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957430Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 2957431Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)
  6. 2957432Protein DNA-binding protein AlbA [82706] (4 species)
    an archaeal chromatin protein modulated by acetylation, a Sir2 substrate
  7. 2957439Species Sulfolobus solfataricus, Sso10b1 [TaxId:2287] [82707] (2 PDB entries)
    gene SSO0962 (AlbA1)
  8. 2957442Domain d1h0ya_: 1h0y A: [76453]
    complexed with so4

Details for d1h0ya_

PDB Entry: 1h0y (more details), 2.8 Å

PDB Description: structure of alba: an archaeal chromatin protein modulated by acetylation
PDB Compounds: (A:) DNA binding protein sso10b

SCOPe Domain Sequences for d1h0ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0ya_ d.68.6.1 (A:) DNA-binding protein AlbA {Sulfolobus solfataricus, Sso10b1 [TaxId: 2287]}
snvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkieik
eirvgsqvvtsqdgrqsrvstieiairkk

SCOPe Domain Coordinates for d1h0ya_:

Click to download the PDB-style file with coordinates for d1h0ya_.
(The format of our PDB-style files is described here.)

Timeline for d1h0ya_: