![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.68: IF3-like [55199] (7 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.6: AlbA-like [82704] (2 families) ![]() |
![]() | Family d.68.6.1: DNA-binding protein AlbA [82705] (1 protein) |
![]() | Protein DNA-binding protein AlbA [82706] (4 species) an archaeal chromatin protein modulated by acetylation, a Sir2 substrate |
![]() | Species Archaeon Sulfolobus solfataricus, Sso10b1 [TaxId:2287] [82707] (2 PDB entries) gene SSO0962 (AlbA1) |
![]() | Domain d1h0xb_: 1h0x B: [76452] |
PDB Entry: 1h0x (more details), 2.6 Å
SCOP Domain Sequences for d1h0xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0xb_ d.68.6.1 (B:) DNA-binding protein AlbA {Archaeon Sulfolobus solfataricus, Sso10b1} snvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkieik eirvgsqvvtsqdgrqsrvstieiairkk
Timeline for d1h0xb_: