Lineage for d1h0xb_ (1h0x B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 258489Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 258566Superfamily d.68.6: DNA-binding protein Sso10b (AlbA) [82704] (1 family) (S)
  5. 258567Family d.68.6.1: DNA-binding protein Sso10b (AlbA) [82705] (1 protein)
  6. 258568Protein DNA-binding protein Sso10b (AlbA) [82706] (1 species)
    an archaeal chromatin protein modulated by acetylation
  7. 258569Species Archaeon Sulfolobus solfataricus [TaxId:2287] [82707] (2 PDB entries)
  8. 258571Domain d1h0xb_: 1h0x B: [76452]

Details for d1h0xb_

PDB Entry: 1h0x (more details), 2.6 Å

PDB Description: structure of alba: an archaeal chromatin protein modulated by acetylation

SCOP Domain Sequences for d1h0xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0xb_ d.68.6.1 (B:) DNA-binding protein Sso10b (AlbA) {Archaeon Sulfolobus solfataricus}
snvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkieik
eirvgsqvvtsqdgrqsrvstieiairkk

SCOP Domain Coordinates for d1h0xb_:

Click to download the PDB-style file with coordinates for d1h0xb_.
(The format of our PDB-style files is described here.)

Timeline for d1h0xb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1h0xa_