Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.6: AlbA-like [82704] (3 families) |
Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins) |
Protein DNA-binding protein AlbA [82706] (4 species) an archaeal chromatin protein modulated by acetylation, a Sir2 substrate |
Species Sulfolobus solfataricus, Sso10b1 [TaxId:2287] [82707] (2 PDB entries) gene SSO0962 (AlbA1) |
Domain d1h0xa_: 1h0x A: [76451] |
PDB Entry: 1h0x (more details), 2.6 Å
SCOPe Domain Sequences for d1h0xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0xa_ d.68.6.1 (A:) DNA-binding protein AlbA {Sulfolobus solfataricus, Sso10b1 [TaxId: 2287]} snvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkieik eirvgsqvvtsqdgrqsrvstieiairkk
Timeline for d1h0xa_: