Lineage for d1h0mc2 (1h0m C:1-164)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417123Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 417289Superfamily d.110.5: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75516] (1 family) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3)-alpha; possibly related to the PAS domain
  5. 417290Family d.110.5.1: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75517] (1 protein)
  6. 417291Protein Transcription factor TraR, N-terminal domain [75518] (1 species)
  7. 417292Species Agrobacterium tumefaciens [TaxId:358] [75519] (2 PDB entries)
  8. 417299Domain d1h0mc2: 1h0m C:1-164 [76447]
    Other proteins in same PDB: d1h0ma1, d1h0mb1, d1h0mc1, d1h0md1

Details for d1h0mc2

PDB Entry: 1h0m (more details), 3 Å

PDB Description: three-dimensional structure of the quorum sensing protein trar bound to its autoinducer and to its target dna

SCOP Domain Sequences for d1h0mc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0mc2 d.110.5.1 (C:1-164) Transcription factor TraR, N-terminal domain {Agrobacterium tumefaciens}
mqhwldkltdlaaiegdecilktgladiadhfgftgyaylhiqhrhitavtnyhrqwqst
yfdkkfealdpvvkrarsrkhiftwsgeherptlskderafydhasdfgirsgitipikt
angfmsmftmasdkpvidldreidavaaaatigqiharisflrt

SCOP Domain Coordinates for d1h0mc2:

Click to download the PDB-style file with coordinates for d1h0mc2.
(The format of our PDB-style files is described here.)

Timeline for d1h0mc2: