Lineage for d1h0mb2 (1h0m B:1-169)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922390Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1923000Superfamily d.110.5: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75516] (1 family) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3)-alpha; possibly related to the PAS domain
    automatically mapped to Pfam PF03472
  5. 1923001Family d.110.5.1: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75517] (1 protein)
  6. 1923002Protein Transcription factor TraR, N-terminal domain [75518] (1 species)
  7. 1923003Species Agrobacterium tumefaciens [TaxId:358] [75519] (2 PDB entries)
  8. 1923009Domain d1h0mb2: 1h0m B:1-169 [76445]
    Other proteins in same PDB: d1h0ma1, d1h0mb1, d1h0mc1, d1h0md1
    complexed with hsl, ooa

Details for d1h0mb2

PDB Entry: 1h0m (more details), 3 Å

PDB Description: three-dimensional structure of the quorum sensing protein trar bound to its autoinducer and to its target dna
PDB Compounds: (B:) transcriptional activator protein trar

SCOPe Domain Sequences for d1h0mb2:

Sequence, based on SEQRES records: (download)

>d1h0mb2 d.110.5.1 (B:1-169) Transcription factor TraR, N-terminal domain {Agrobacterium tumefaciens [TaxId: 358]}
mqhwldkltdlaaiegdecilktgladiadhfgftgyaylhiqhrhitavtnyhrqwqst
yfdkkfealdpvvkrarsrkhiftwsgeherptlskderafydhasdfgirsgitipikt
angfmsmftmasdkpvidldreidavaaaatigqiharisflrttptae

Sequence, based on observed residues (ATOM records): (download)

>d1h0mb2 d.110.5.1 (B:1-169) Transcription factor TraR, N-terminal domain {Agrobacterium tumefaciens [TaxId: 358]}
mqhwldkltdlaaiegdecilktgladiadhfgftgyaylhiqhrhitavtnyhrqwqst
yfdkkfealdpvvkrarsrkhiftwsgeherptlskderafydhasdfgirsgitipikt
angfmsmftmasdkpvididavaaaatigqiharisflrttptae

SCOPe Domain Coordinates for d1h0mb2:

Click to download the PDB-style file with coordinates for d1h0mb2.
(The format of our PDB-style files is described here.)

Timeline for d1h0mb2: