![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.5: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75516] (1 family) ![]() alpha(2)-beta(2)-alpha(2)-beta(3)-alpha; possibly related to the PAS domain automatically mapped to Pfam PF03472 |
![]() | Family d.110.5.1: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors [75517] (1 protein) |
![]() | Protein Transcription factor TraR, N-terminal domain [75518] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [75519] (2 PDB entries) |
![]() | Domain d1h0ma2: 1h0m A:1-165 [76443] Other proteins in same PDB: d1h0ma1, d1h0mb1, d1h0mc1, d1h0md1 complexed with hsl, ooa |
PDB Entry: 1h0m (more details), 3 Å
SCOPe Domain Sequences for d1h0ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0ma2 d.110.5.1 (A:1-165) Transcription factor TraR, N-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} mqhwldkltdlaaiegdecilktgladiadhfgftgyaylhiqhrhitavtnyhrqwqst yfdkkfealdpvvkrarsrkhiftwsgeherptlskderafydhasdfgirsgitipikt angfmsmftmasdkpvidldreidavaaaatigqiharisflrtt
Timeline for d1h0ma2: