Lineage for d1h0ma1 (1h0m A:170-234)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480304Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1480336Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins)
    contains additional, fourth helix in the C-terminal extension
  6. 1480362Protein Quorum-sensing transcription factor TraR, C-terminal domain [74690] (1 species)
  7. 1480363Species Agrobacterium tumefaciens [TaxId:358] [74691] (2 PDB entries)
  8. 1480368Domain d1h0ma1: 1h0m A:170-234 [76442]
    Other proteins in same PDB: d1h0ma2, d1h0mb2, d1h0mc2, d1h0md2
    complexed with hsl, ooa

Details for d1h0ma1

PDB Entry: 1h0m (more details), 3 Å

PDB Description: three-dimensional structure of the quorum sensing protein trar bound to its autoinducer and to its target dna
PDB Compounds: (A:) transcriptional activator protein trar

SCOPe Domain Sequences for d1h0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0ma1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]}
daawldpkeatylrwiavgktmeeiadvegvkynsvrvklreamkrfdvrskahltalai
rrkli

SCOPe Domain Coordinates for d1h0ma1:

Click to download the PDB-style file with coordinates for d1h0ma1.
(The format of our PDB-style files is described here.)

Timeline for d1h0ma1: