SCOP 1.73: Domain d1h0hk1: 1h0h K:813-977

Lineage for d1h0hk1 (1h0h K:813-977)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Tungsten containing formate dehydrogenase, large subunit [82138] (1 species)

7. Species Desulfovibrio gigas [TaxId:879] [82139] (1 PDB entry)

8. Domain d1h0hk1: 1h0h K:813-977 [76438]
   Other proteins in same PDB: d1h0ha2, d1h0hb_, d1h0hk2, d1h0hl_
   complexed with 2md, ca, cse, epe, fs4, mgd, s, w

Details for d1h0hk1

PDB Entry: 1h0h, 1.8 Å

PDB Description: tungsten containing formate dehydrogenase from desulfovibrio gigas

PDB Compounds: (K:) formate dehydrogenase (large subunit)

SCOP Domain Sequences for d1h0hk1:

Sequence; same for both SEQRES and ATOM records:

>d1h0hk1 b.52.2.2 (K:813-977) Tungsten containing formate dehydrogenase, large subunit {Desulfovibrio gigas [TaxId: 879]}
epmecpviehpfsktlhnptalhfateekavcdprypficstyrvtehwqtglmtrntpw
lleaepqmfcemseelatlrgikngdkvilesvrgklwakaiitkrikpfaiqgqqvhmv
gipwhygwsfpknggdaaniltpsvgnpntgipetkafmvnvtka

Timeline for d1h0hk1:

• d1h0hk1 first appeared in SCOP 1.63
  
• d1h0hk1 appears in SCOP 1.71
  
• d1h0hk1 appears in SCOP 1.75
  
• d1h0hk1 appears in the current release, SCOPe 2.08