![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
![]() | Superfamily b.52.2: ADC-like [50692] (3 families) ![]() |
![]() | Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (8 proteins) molybdopterine enzyme |
![]() | Protein Tungsten containing formate dehydrogenase, large subunit [82138] (1 species) |
![]() | Species Desulfovibrio gigas [TaxId:879] [82139] (1 PDB entry) |
![]() | Domain d1h0hk1: 1h0h K:813-977 [76438] Other proteins in same PDB: d1h0ha2, d1h0hb_, d1h0hk2, d1h0hl_ complexed with 2md, ca, cse, epe, fs4, mgd, s, w |
PDB Entry: 1h0h (more details), 1.8 Å
SCOP Domain Sequences for d1h0hk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0hk1 b.52.2.2 (K:813-977) Tungsten containing formate dehydrogenase, large subunit {Desulfovibrio gigas} epmecpviehpfsktlhnptalhfateekavcdprypficstyrvtehwqtglmtrntpw lleaepqmfcemseelatlrgikngdkvilesvrgklwakaiitkrikpfaiqgqqvhmv gipwhygwsfpknggdaaniltpsvgnpntgipetkafmvnvtka
Timeline for d1h0hk1:
![]() Domains from other chains: (mouse over for more information) d1h0ha1, d1h0ha2, d1h0hb_, d1h0hl_ |