SCOP 1.71: Domain d1h0hb_: 1h0h B:

Lineage for d1h0hb_ (1h0h B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (9 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other

6. Protein Tungsten containing formate dehydrogenase, small subunit [82664] (1 species)

7. Species Desulfovibrio gigas [TaxId:879] [82665] (1 PDB entry)

8. Domain d1h0hb_: 1h0h B: [76437]
   Other proteins in same PDB: d1h0ha1, d1h0ha2, d1h0hk1, d1h0hk2

Details for d1h0hb_

PDB Entry: 1h0h, 1.8 Å

PDB Description: tungsten containing formate dehydrogenase from desulfovibrio gigas

SCOP Domain Sequences for d1h0hb_:

Sequence; same for both SEQRES and ATOM records:

>d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas}
skgffvdttrctacrgcqvackqwhgnpatptentgfhqnppdfnfhtyklvrmheqeid
gridwlffpdqcrhciappckatadmedesaiihddatgcvlftpktkdledyesvisac
pydvprkvaesnqmakcdmcidritnglrpacvtscptgamnfgdlsemeamasarlaei
kaaysdaklcdpddvrvifltahnpklyheyava

Timeline for d1h0hb_:

• d1h0hb_ first appeared in SCOP 1.63
  
• d1h0hb_ appears in SCOP 1.69
  
• d1h0hb_ appears in SCOP 1.73
  
• d1h0hb_ appears in the current release, SCOPe 2.08