Lineage for d1h0ha2 (1h0h A:1-812)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140533Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2140534Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 2140535Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 protein domains)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2140645Protein Tungsten containing formate dehydrogenase, large subunit [82536] (1 species)
  7. 2140646Species Desulfovibrio gigas [TaxId:879] [82537] (1 PDB entry)
  8. 2140647Domain d1h0ha2: 1h0h A:1-812 [76436]
    Other proteins in same PDB: d1h0ha1, d1h0hb_, d1h0hk1, d1h0hl_
    complexed with 2md, ca, epe, mgd, sf4, unx, w

Details for d1h0ha2

PDB Entry: 1h0h (more details), 1.8 Å

PDB Description: tungsten containing formate dehydrogenase from desulfovibrio gigas
PDB Compounds: (A:) formate dehydrogenase subunit alpha

SCOPe Domain Sequences for d1h0ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0ha2 c.81.1.1 (A:1-812) Tungsten containing formate dehydrogenase, large subunit {Desulfovibrio gigas [TaxId: 879]}
atmalktvdakqttsvccycsvgcglivhtdkktnrainvegdpdhpinegslcakgast
wqlaenerrpanplyrapgsdqweekswdwmldtiaervaktreatfvtknakgqvvnrc
dgiasvgsaamdneecwiyqawlrslglfyiehqariahsatvaalaesygrgamtnhwi
dlknsdvilmmgsnpaenhpisfkwvmrakdkgatlihvdprytrtstkcdlyaplrsgs
diaflngmtkyilekelyfkdyvvnytnasfivgegfafeeglfagynketrkydkskwg
ferdengnpkrdetlkhprcvfqimkkhyerydldkisaicgtpkelilkvydaycatgk
pdkagtimyamgwtqhtvgvqniramsinqlllgnigvagggvnalrgeanvqgstdhgl
lmhiypgylgtarasiptyeeytkkftpvskdpqsanwwsnfpkysasyiksmwpdadln
eaygylpkgedgkdyswltlfddmfqgkikgffawgqnpacsgansnktrealtkldwmv
nvnifdnetgsfwrgpdmdpkkiktevfflpcavaiekegsisnsgrwmqwryvgpeprk
naipdgdlivelakrvqkllaktpgklaapvtklktdywvndhghfdphkiaklingfal
kdfkvgdveykagqqiatfghlqadgsttsgcwiytgsytekgnmaarrdktqtdmqaki
glypgwtwawpvnrriiynrasvdlngkpyapekavvewnaaekkwvgdvpdgpwppqad
kekgkrafimkpegyaylygpgredgplpeyy

SCOPe Domain Coordinates for d1h0ha2:

Click to download the PDB-style file with coordinates for d1h0ha2.
(The format of our PDB-style files is described here.)

Timeline for d1h0ha2: