Lineage for d1h0ha1 (1h0h A:813-977)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 563620Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 563643Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 563667Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (9 proteins)
    molybdopterine enzyme
  6. 563762Protein Tungsten containing formate dehydrogenase, large subunit [82138] (1 species)
  7. 563763Species Desulfovibrio gigas [TaxId:879] [82139] (1 PDB entry)
  8. 563764Domain d1h0ha1: 1h0h A:813-977 [76435]
    Other proteins in same PDB: d1h0ha2, d1h0hb_, d1h0hk2, d1h0hl_

Details for d1h0ha1

PDB Entry: 1h0h (more details), 1.8 Å

PDB Description: tungsten containing formate dehydrogenase from desulfovibrio gigas

SCOP Domain Sequences for d1h0ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0ha1 b.52.2.2 (A:813-977) Tungsten containing formate dehydrogenase, large subunit {Desulfovibrio gigas}
epmecpviehpfsktlhnptalhfateekavcdprypficstyrvtehwqtglmtrntpw
lleaepqmfcemseelatlrgikngdkvilesvrgklwakaiitkrikpfaiqgqqvhmv
gipwhygwsfpknggdaaniltpsvgnpntgipetkafmvnvtka

SCOP Domain Coordinates for d1h0ha1:

Click to download the PDB-style file with coordinates for d1h0ha1.
(The format of our PDB-style files is described here.)

Timeline for d1h0ha1: