Lineage for d1h0aa_ (1h0a A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340111Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2340112Family a.118.9.1: ENTH domain [48465] (2 proteins)
    automatically mapped to Pfam PF01417
  6. 2340113Protein Epsin 1 [48466] (2 species)
  7. 2340116Species Norway rat (Rattus norvegicus) [TaxId:10116] [48467] (3 PDB entries)
  8. 2340118Domain d1h0aa_: 1h0a A: [76434]
    complexed with Ins(1,4,5)P3
    complexed with dio, i3p

Details for d1h0aa_

PDB Entry: 1h0a (more details), 1.7 Å

PDB Description: epsin enth bound to ins(1,4,5)p3
PDB Compounds: (A:) epsin

SCOPe Domain Sequences for d1h0aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0aa_ a.118.9.1 (A:) Epsin 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mstsslrrqmknivhnyseaeikvreatsndpwgpssslmseiadltynvvafseimsmi
wkrlndhgknwrhvykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdgkdqg
vnvrekakqlvallrdedrlreerahalktkeklaqta

SCOPe Domain Coordinates for d1h0aa_:

Click to download the PDB-style file with coordinates for d1h0aa_.
(The format of our PDB-style files is described here.)

Timeline for d1h0aa_: