Lineage for d1gzva_ (1gzv A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140302Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 protein domains)
    permutation of the double-SIS domain fold
    automatically mapped to Pfam PF00342
  6. 2140303Protein Phosphoglucose isomerase, PGI [53702] (8 species)
    moonlights as neuroleukin, autocrine motility factor, and differentiation mediator
  7. 2140336Species Pig (Sus scrofa) [TaxId:9823] [75316] (2 PDB entries)
  8. 2140338Domain d1gzva_: 1gzv A: [76432]
    complexed with pa5

Details for d1gzva_

PDB Entry: 1gzv (more details), 3.51 Å

PDB Description: the crystal structure of phosphoglucose isomerase from pig muscle complexed with 5-phosphoarabinonate
PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d1gzva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzva_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Pig (Sus scrofa) [TaxId: 9823]}
aaltqnpqfkklqtwyhehrsdlnlrrlfegdkdrfnhfslnlntnhgrilldysknlvt
eavmqmlvdlaksrgveaarermfngekinftedravlhvalrnrsntpilvdgkdvmpe
vnrvlekmksfckrvrsgewkgysgksitdvinigiggsdlgplmvtealkpysaegprv
wfvsnidgthiaktlatlnpesslfiiasktfttqetitnaetakewflqsakdpsavak
hfvalstnttkvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsgah
wmdqhfrttpleknapvllallgiwyinffgcethamlpydqylhrfaayfqqgdmesng
kyitksgtrvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkglh
hkillanflaqtealmkgksteearkelqaagkspedfekllphkvfegnrptnsivftk
ltpfilgaliamyehkifvqgviwdinsfdqwgvelgkqlakkiepeldgsspvtshdss
tnglinfikqerea

SCOPe Domain Coordinates for d1gzva_:

Click to download the PDB-style file with coordinates for d1gzva_.
(The format of our PDB-style files is described here.)

Timeline for d1gzva_: