Lineage for d1gztd_ (1gzt D:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 472213Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 472214Superfamily b.115.1: Calcium-mediated lectin [82026] (1 family) (S)
  5. 472215Family b.115.1.1: Calcium-mediated lectin [82027] (2 proteins)
  6. 472216Protein Fucose-binding lectin II (PA-LII) [82028] (1 species)
  7. 472217Species Pseudomonas aeruginosa [TaxId:287] [82029] (7 PDB entries)
  8. 472225Domain d1gztd_: 1gzt D: [76431]

Details for d1gztd_

PDB Entry: 1gzt (more details), 1.3 Å

PDB Description: pseudomonas aeruginosa lectin ii (pa-iil) together with fucose

SCOP Domain Sequences for d1gztd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gztd_ b.115.1.1 (D:) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOP Domain Coordinates for d1gztd_:

Click to download the PDB-style file with coordinates for d1gztd_.
(The format of our PDB-style files is described here.)

Timeline for d1gztd_: