SCOPe 2.05: Domain d1gzsc_: 1gzs C:

Lineage for d1gzsc_ (1gzs C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (28 PDB entries)

8. Domain d1gzsc_: 1gzs C: [76426]
   Other proteins in same PDB: d1gzsb_, d1gzsd_
   complexed with so4

Details for d1gzsc_

PDB Entry: 1gzs, 2.3 Å

PDB Description: crystal structure of the complex between the gef domain of the salmonella typhimurium sope toxin and human cdc42

PDB Compounds: (C:) GTP-binding protein

SCOPe Domain Sequences for d1gzsc_:

Sequence; same for both SEQRES and ATOM records:

>d1gzsc_ c.37.1.8 (C:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale

Timeline for d1gzsc_:

• d1gzsc_ first appeared in SCOP 1.63
  
• d1gzsc_ appears in SCOPe 2.04
  
• d1gzsc_ appears in SCOPe 2.06
  
• d1gzsc_ appears in the current release, SCOPe 2.08