Lineage for d1gzsc_ (1gzs C:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830012Protein CDC42 [52619] (2 species)
  7. 830013Species Human (Homo sapiens) [TaxId:9606] [52620] (19 PDB entries)
  8. 830025Domain d1gzsc_: 1gzs C: [76426]
    Other proteins in same PDB: d1gzsb_, d1gzsd_
    complexed with so4

Details for d1gzsc_

PDB Entry: 1gzs (more details), 2.3 Å

PDB Description: crystal structure of the complex between the gef domain of the salmonella typhimurium sope toxin and human cdc42
PDB Compounds: (C:) GTP-binding protein

SCOP Domain Sequences for d1gzsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzsc_ c.37.1.8 (C:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale

SCOP Domain Coordinates for d1gzsc_:

Click to download the PDB-style file with coordinates for d1gzsc_.
(The format of our PDB-style files is described here.)

Timeline for d1gzsc_: