SCOP 1.63: Domain d1gzl.2: 1gzl B:,D:

Lineage for d1gzl.2 (1gzl B:,D:)

1. Root: SCOP 1.63

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (6 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (3 species)
   coiled coil; biological unit: trimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (16 PDB entries)

8. Domain d1gzl.2: 1gzl B:,D: [76423]
   fusion protein between gp41 and GCN4 fragments; complex with a cell entry inhibitor

Details for d1gzl.2

PDB Entry: 1gzl, 1.8 Å

PDB Description: crystal structure of c14linkmid/iqn17: a cross-linked inhibitor of hiv-1 entry bound to the gp41 hydrophobic pocket

SCOP Domain Sequences for d1gzl.2:

Sequence; same for both SEQRES and ATOM records:

>g1gzl.2 h.3.2.1 (B:,D:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1}
rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqarilXweewdreienyt

Timeline for d1gzl.2:

• d1gzl.2 is new in SCOP 1.63
  
• d1gzl.2 appears in SCOP 1.65
  
• d1gzl.2 appears in the current release, SCOPe 2.08