SCOP 1.75: Domain d1gz5c_: 1gz5 C:

Lineage for d1gz5c_ (1gz5 C:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (11 families)

5. Family c.87.1.6: Trehalose-6-phosphate synthase, OtsA [82540] (1 protein)
   family 20 glycosyltransferase; good structural similarity in the active site to the Oligosaccharide phosphorylases

6. Protein Trehalose-6-phosphate synthase, OtsA [82541] (1 species)

7. Species Escherichia coli [TaxId:562] [82542] (3 PDB entries)

8. Domain d1gz5c_: 1gz5 C: [76408]

Details for d1gz5c_

PDB Entry: 1gz5, 2.43 Å

PDB Description: trehalose-6-phosphate synthase. otsa

PDB Compounds: (C:) alpha-trehalose-phosphate synthase

SCOP Domain Sequences for d1gz5c_:

Sequence; same for both SEQRES and ATOM records:

>d1gz5c_ c.87.1.6 (C:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]}
srlvvvsnriappdehaasagglavgilgalkaagglwfgwsgetgnedqplkkvkkgni
twasfnlseqdldeyynqfsnavlwpafhyrldlvqfqrpawdgylrvnalladkllpll
qdddiiwihdyhllpfahelrkrgvnnrigfflhipfptpeifnalptydtlleqlcdyd
llgfqtendrlafldclsnltrvttrsakshtawgkafrtevypigiepkeiakqaagpl
ppklaqlkaelknvqnifsverldyskglperflayeallekypqhhgkirytqiaptsr
gdvqayqdirhqleneagringkygqlgwtplyylnqhfdrkllmkifrysdvglvtplr
dgmnlvakeyvaaqdpanpgvlvlsqfagaaneltsalivnpydrdevaaaldraltmsl
aerisrhaemldvivkndinhwqecfisdlkqivpr

Timeline for d1gz5c_:

• d1gz5c_ first appeared in SCOP 1.63
  
• d1gz5c_ appears in SCOP 1.73
  
• d1gz5c_ appears in SCOPe 2.01
  
• d1gz5c_ appears in the current release, SCOPe 2.08