Lineage for d1gz5a_ (1gz5 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 845255Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 845256Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (11 families) (S)
  5. 845501Family c.87.1.6: Trehalose-6-phosphate synthase, OtsA [82540] (1 protein)
    family 20 glycosyltransferase; good structural similarity in the active site to the Oligosaccharide phosphorylases
  6. 845502Protein Trehalose-6-phosphate synthase, OtsA [82541] (1 species)
  7. 845503Species Escherichia coli [TaxId:562] [82542] (3 PDB entries)
  8. 845508Domain d1gz5a_: 1gz5 A: [76406]

Details for d1gz5a_

PDB Entry: 1gz5 (more details), 2.43 Å

PDB Description: trehalose-6-phosphate synthase. otsa
PDB Compounds: (A:) alpha-trehalose-phosphate synthase

SCOP Domain Sequences for d1gz5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gz5a_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]}
srlvvvsnriappdehaasagglavgilgalkaagglwfgwsgetgnedqplkkvkkgni
twasfnlseqdldeyynqfsnavlwpafhyrldlvqfqrpawdgylrvnalladkllpll
qdddiiwihdyhllpfahelrkrgvnnrigfflhipfptpeifnalptydtlleqlcdyd
llgfqtendrlafldclsnltrvttrsakshtawgkafrtevypigiepkeiakqaagpl
ppklaqlkaelknvqnifsverldyskglperflayeallekypqhhgkirytqiaptsr
gdvqayqdirhqleneagringkygqlgwtplyylnqhfdrkllmkifrysdvglvtplr
dgmnlvakeyvaaqdpanpgvlvlsqfagaaneltsalivnpydrdevaaaldraltmsl
aerisrhaemldvivkndinhwqecfisdlkqivpr

SCOP Domain Coordinates for d1gz5a_:

Click to download the PDB-style file with coordinates for d1gz5a_.
(The format of our PDB-style files is described here.)

Timeline for d1gz5a_: