Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (11 families) |
Family c.87.1.6: Trehalose-6-phosphate synthase, OtsA [82540] (1 protein) family 20 glycosyltransferase; good structural similarity in the active site to the Oligosaccharide phosphorylases |
Protein Trehalose-6-phosphate synthase, OtsA [82541] (1 species) |
Species Escherichia coli [TaxId:562] [82542] (3 PDB entries) |
Domain d1gz5a_: 1gz5 A: [76406] |
PDB Entry: 1gz5 (more details), 2.43 Å
SCOP Domain Sequences for d1gz5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gz5a_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} srlvvvsnriappdehaasagglavgilgalkaagglwfgwsgetgnedqplkkvkkgni twasfnlseqdldeyynqfsnavlwpafhyrldlvqfqrpawdgylrvnalladkllpll qdddiiwihdyhllpfahelrkrgvnnrigfflhipfptpeifnalptydtlleqlcdyd llgfqtendrlafldclsnltrvttrsakshtawgkafrtevypigiepkeiakqaagpl ppklaqlkaelknvqnifsverldyskglperflayeallekypqhhgkirytqiaptsr gdvqayqdirhqleneagringkygqlgwtplyylnqhfdrkllmkifrysdvglvtplr dgmnlvakeyvaaqdpanpgvlvlsqfagaaneltsalivnpydrdevaaaldraltmsl aerisrhaemldvivkndinhwqecfisdlkqivpr
Timeline for d1gz5a_: