Lineage for d1gxua_ (1gxu A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862748Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (2 families) (S)
  5. 862749Family d.58.10.1: Acylphosphatase-like [54976] (3 proteins)
  6. 862765Protein Hydrogenase maturation protein HypF N-terminal domain (HypF-ACP) [82675] (1 species)
  7. 862766Species Escherichia coli [TaxId:562] [82676] (2 PDB entries)
  8. 862767Domain d1gxua_: 1gxu A: [76378]
    complexed with cp

Details for d1gxua_

PDB Entry: 1gxu (more details), 1.27 Å

PDB Description: hydrogenase maturation protein hypf "acylphosphatase-like" n-terminal domain (hypf-acp) in complex with a substrate. crystal grown in the presence of carbamoylphosphate
PDB Compounds: (A:) hydrogenase maturation protein hypf

SCOP Domain Sequences for d1gxua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxua_ d.58.10.1 (A:) Hydrogenase maturation protein HypF N-terminal domain (HypF-ACP) {Escherichia coli [TaxId: 562]}
ntscgvqlrirgkvqgvgfrpfvwqlaqqlnlhgdvcndgdgvevrlredpevflvqlyq
hcpplaridsverepfiwsalpteftir

SCOP Domain Coordinates for d1gxua_:

Click to download the PDB-style file with coordinates for d1gxua_.
(The format of our PDB-style files is described here.)

Timeline for d1gxua_: