Lineage for d1gxta_ (1gxt A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909557Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) (S)
  5. 1909558Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)
    automatically mapped to Pfam PF00708
  6. 1909574Protein Hydrogenase maturation protein HypF N-terminal domain (HypF-ACP) [82675] (1 species)
  7. 1909575Species Escherichia coli [TaxId:562] [82676] (2 PDB entries)
  8. 1909577Domain d1gxta_: 1gxt A: [76377]
    complexed with cl, so4, trs

Details for d1gxta_

PDB Entry: 1gxt (more details), 1.3 Å

PDB Description: hydrogenase maturation protein hypf "acylphosphatase-like" n-terminal domain (hypf-acp) in complex with sulfate
PDB Compounds: (A:) hydrogenase maturation protein hypf

SCOPe Domain Sequences for d1gxta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxta_ d.58.10.1 (A:) Hydrogenase maturation protein HypF N-terminal domain (HypF-ACP) {Escherichia coli [TaxId: 562]}
ntscgvqlrirgkvqgvgfrpfvwqlaqqlnlhgdvcndgdgvevrlredpevflvqlyq
hcpplaridsverepfiwsqlpteftir

SCOPe Domain Coordinates for d1gxta_:

Click to download the PDB-style file with coordinates for d1gxta_.
(The format of our PDB-style files is described here.)

Timeline for d1gxta_: