Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) |
Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins) automatically mapped to Pfam PF00708 |
Protein Hydrogenase maturation protein HypF N-terminal domain (HypF-ACP) [82675] (1 species) |
Species Escherichia coli [TaxId:562] [82676] (2 PDB entries) |
Domain d1gxta_: 1gxt A: [76377] complexed with cl, so4, trs |
PDB Entry: 1gxt (more details), 1.3 Å
SCOPe Domain Sequences for d1gxta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gxta_ d.58.10.1 (A:) Hydrogenase maturation protein HypF N-terminal domain (HypF-ACP) {Escherichia coli [TaxId: 562]} ntscgvqlrirgkvqgvgfrpfvwqlaqqlnlhgdvcndgdgvevrlredpevflvqlyq hcpplaridsverepfiwsqlpteftir
Timeline for d1gxta_: