SCOPe 2.08: Domain d1gxs.1: 1gxs A:,B:

Lineage for d1gxs.1 (1gxs A:,B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.5: Serine carboxypeptidase-like [53499] (4 proteins)
   automatically mapped to Pfam PF00450

6. Protein Hydroxynitrile lyase [82500] (1 species)
   a novel cyanogenic enzyme

7. Species Sorghum (Sorghum bicolor) [TaxId:4558] [82501] (1 PDB entry)

8. Domain d1gxs.1: 1gxs A:,B: [76375]
   complexed with bez, dka, nag

Details for d1gxs.1

PDB Entry: 1gxs, 2.3 Å

PDB Description: crystal structure of hydroxynitrile lyase from sorghum bicolor in complex with inhibitor benzoic acid: a novel cyanogenic enzyme

PDB Compounds: (A:) p-(s)-hydroxymandelonitrile lyase chain a, (B:) p-(s)-hydroxymandelonitrile lyase chain b

SCOPe Domain Sequences for d1gxs.1:

Sequence; same for both SEQRES and ATOM records:

>g1gxs.1 c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [TaxId: 4558]}
qqeddrilglpgqpngvafgmyggyvtiddnngralyywfqeadtadpaaaplvlwlngg
pgcssiglgamqelgafrvhtngeslllneyawnkaanilfaespagvgfsysntssdls
mgddkmaqdtytflvkwferfphynyrefyiagesghfipqlsqvvyrnrnnspfinfqg
llvssgltndhedmigmfeswwhhglisdetrdsglkvcpgtsfmhptpectevwnkala
eqgninpytiytptcdrepspyqrrfwXlppydpcavfnsinylnlpevqtalhanvsgi
veypwtvcsntifdqwgqaaddllpvyreliqaglrvwvysgdtdsvvpvsstrrslaal
elpvktswypwymapterevggwsvqyegltyvtvrgaghlvpvhrpaqafllfkqflkg
epmpae

Timeline for d1gxs.1:

• d1gxs.1 first appeared in SCOP 1.63
  
• d1gxs.1 appears in SCOPe 2.07