Lineage for d1gxoa_ (1gxo A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2336014Superfamily a.102.5: Family 10 polysaccharide lyase [81853] (1 family) (S)
  5. 2336015Family a.102.5.1: Family 10 polysaccharide lyase [81854] (1 protein)
    incomplete toroid made of four hairpins
  6. 2336016Protein Polygalacturonic acid lyase (pectate lyase) [81855] (2 species)
  7. 2336019Species Cellvibrio cellulosa [TaxId:155077] [81856] (3 PDB entries)
  8. 2336023Domain d1gxoa_: 1gxo A: [76374]
    complexed with ca; mutant

Details for d1gxoa_

PDB Entry: 1gxo (more details), 2.05 Å

PDB Description: mutant d189a of family 10 polysaccharide lyase from cellvibrio cellulosa in complex with trigalaturonic acid
PDB Compounds: (A:) pectate lyase

SCOPe Domain Sequences for d1gxoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxoa_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]}
rmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvgnggggnesgti
angatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfyplkggysdhat
fndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilkaqwkqngvltv
wcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavragvawfnsprt
ylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyditqmslerrtg
yswggnygtsiinfaqkvgy

SCOPe Domain Coordinates for d1gxoa_:

Click to download the PDB-style file with coordinates for d1gxoa_.
(The format of our PDB-style files is described here.)

Timeline for d1gxoa_: