Lineage for d1gxna_ (1gxn A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330024Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2330810Superfamily a.102.5: Family 10 polysaccharide lyase [81853] (1 family) (S)
  5. 2330811Family a.102.5.1: Family 10 polysaccharide lyase [81854] (1 protein)
    incomplete toroid made of four hairpins
  6. 2330812Protein Polygalacturonic acid lyase (pectate lyase) [81855] (2 species)
  7. 2330815Species Cellvibrio cellulosa [TaxId:155077] [81856] (3 PDB entries)
  8. 2330818Domain d1gxna_: 1gxn A: [76373]

Details for d1gxna_

PDB Entry: 1gxn (more details), 1.5 Å

PDB Description: family 10 polysaccharide lyase from cellvibrio cellulosa
PDB Compounds: (A:) pectate lyase

SCOPe Domain Sequences for d1gxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxna_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]}
tgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvgnggggnesg
tidngatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfyplkggysdh
atfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilkaqwkqngvl
tvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavragvawfnsp
rtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyditqmslerr
tgyswggnygtsiinfaqkvgyl

SCOPe Domain Coordinates for d1gxna_:

Click to download the PDB-style file with coordinates for d1gxna_.
(The format of our PDB-style files is described here.)

Timeline for d1gxna_: