Lineage for d1gxmb_ (1gxm B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1498423Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1499128Superfamily a.102.5: Family 10 polysaccharide lyase [81853] (1 family) (S)
  5. 1499129Family a.102.5.1: Family 10 polysaccharide lyase [81854] (1 protein)
    incomplete toroid made of four hairpins
  6. 1499130Protein Polygalacturonic acid lyase (pectate lyase) [81855] (2 species)
  7. 1499133Species Cellvibrio cellulosa [TaxId:155077] [81856] (3 PDB entries)
  8. 1499135Domain d1gxmb_: 1gxm B: [76372]
    complexed with gol

Details for d1gxmb_

PDB Entry: 1gxm (more details), 1.32 Å

PDB Description: family 10 polysaccharide lyase from cellvibrio cellulosa
PDB Compounds: (B:) pectate lyase

SCOPe Domain Sequences for d1gxmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxmb_ a.102.5.1 (B:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]}
glvprgshmtgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvg
nggggnesgtidngatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfy
plkggysdhatfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilk
aqwkqngvltvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavr
agvawfnsprtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyd
itqmslerrtgyswggnygtsiinfaqkvgyl

SCOPe Domain Coordinates for d1gxmb_:

Click to download the PDB-style file with coordinates for d1gxmb_.
(The format of our PDB-style files is described here.)

Timeline for d1gxmb_: