Lineage for d1gxma_ (1gxm A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742882Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1743604Superfamily a.102.5: Family 10 polysaccharide lyase [81853] (1 family) (S)
  5. 1743605Family a.102.5.1: Family 10 polysaccharide lyase [81854] (1 protein)
    incomplete toroid made of four hairpins
  6. 1743606Protein Polygalacturonic acid lyase (pectate lyase) [81855] (2 species)
  7. 1743609Species Cellvibrio cellulosa [TaxId:155077] [81856] (3 PDB entries)
  8. 1743610Domain d1gxma_: 1gxm A: [76371]
    complexed with gol

Details for d1gxma_

PDB Entry: 1gxm (more details), 1.32 Å

PDB Description: family 10 polysaccharide lyase from cellvibrio cellulosa
PDB Compounds: (A:) pectate lyase

SCOPe Domain Sequences for d1gxma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]}
mtgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvgnggggnes
gtidngatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfyplkggysd
hatfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilkaqwkqngv
ltvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavragvawfns
prtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyditqmsler
rtgyswggnygtsiinfaqkvgyl

SCOPe Domain Coordinates for d1gxma_:

Click to download the PDB-style file with coordinates for d1gxma_.
(The format of our PDB-style files is described here.)

Timeline for d1gxma_: