Lineage for d1gxma_ (1gxm A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216372Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 216584Superfamily a.102.5: Family 10 polysaccharide lyase [81853] (1 family) (S)
  5. 216585Family a.102.5.1: Family 10 polysaccharide lyase [81854] (1 protein)
    incomlete toroid made of four haipins
  6. 216586Protein Polygalacturonic acid lyase (pectate lyase) [81855] (1 species)
  7. 216587Species Cellvibrio cellulosa [TaxId:155077] [81856] (3 PDB entries)
  8. 216588Domain d1gxma_: 1gxm A: [76371]

Details for d1gxma_

PDB Entry: 1gxm (more details), 1.32 Å

PDB Description: family 10 polysaccharide lyase from cellvibrio cellulosa

SCOP Domain Sequences for d1gxma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa}
mtgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvgnggggnes
gtidngatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfyplkggysd
hatfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilkaqwkqngv
ltvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavragvawfns
prtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyditqmsler
rtgyswggnygtsiinfaqkvgyl

SCOP Domain Coordinates for d1gxma_:

Click to download the PDB-style file with coordinates for d1gxma_.
(The format of our PDB-style files is described here.)

Timeline for d1gxma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gxmb_