Lineage for d1gwqb_ (1gwq B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008578Protein Estrogen receptor alpha [48519] (1 species)
  7. 2008579Species Human (Homo sapiens) [TaxId:9606] [48520] (64 PDB entries)
    Uniprot P03372 307-551
  8. 2008655Domain d1gwqb_: 1gwq B: [76367]
    complex with raloxifene core and TIF2 NRbox2 peptide; chains C and D
    protein/DNA complex; complexed with ztw

Details for d1gwqb_

PDB Entry: 1gwq (more details), 2.45 Å

PDB Description: human oestrogen receptor alpha ligand-binding domain in complex with raloxifene core and tif2 nrbox2 peptide
PDB Compounds: (B:) oestrogen receptor

SCOPe Domain Sequences for d1gwqb_:

Sequence, based on SEQRES records: (download)

>d1gwqb_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
lemldahr

Sequence, based on observed residues (ATOM records): (download)

>d1gwqb_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
skknslalsltadqmvsalldaeppilysefseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemlda
hr

SCOPe Domain Coordinates for d1gwqb_:

Click to download the PDB-style file with coordinates for d1gwqb_.
(The format of our PDB-style files is described here.)

Timeline for d1gwqb_: