Lineage for d1gwib_ (1gwi B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2004998Protein Cyp154c1 monooxygenase [81867] (1 species)
    functionalizes macrolide ring systems
  7. 2004999Species Streptomyces coelicolor [TaxId:1902] [81868] (1 PDB entry)
  8. 2005001Domain d1gwib_: 1gwi B: [76365]
    complexed with hem, so4

Details for d1gwib_

PDB Entry: 1gwi (more details), 1.92 Å

PDB Description: the 1.92 a structure of streptomyces coelicolor a3(2) cyp154c1: a new monooxygenase that functionalizes macrolide ring systems
PDB Compounds: (B:) cytochrome p450 154c1

SCOPe Domain Sequences for d1gwib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwib_ a.104.1.1 (B:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]}
aripldpfvtdldgesarlraagplaavelpggvpvwavthhaeakalltdprlvkdinv
wgawrrgeipadwpliglanpgrsmltvdgaehrrlrtlvaqaltvrrvehmrgritelt
drlldelpadggvvdlkaafayplpmyvvadlmgieearlprlkvlfekffstqtppeev
vatltelasimtdtvaakraapgddltsaliqasengdhltdaeivstlqlmvaaghett
islivnavvnlsthpeqralvlsgeaewsavveetlrfstptshvlirfaaedvpvgdrv
ipagdalivsygalgrderahgptadrfdltrtsgnrhisfghgphvcpgaalsrmeagv
alpalyarfphldlavpaaelrnkpvvtqndlfelpvrlah

SCOPe Domain Coordinates for d1gwib_:

Click to download the PDB-style file with coordinates for d1gwib_.
(The format of our PDB-style files is described here.)

Timeline for d1gwib_: