Lineage for d1gwba_ (1gwb A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459922Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2459991Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2460154Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 2460176Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (2 species)
  7. 2460177Species Human (Homo sapiens) [TaxId:9606] [75144] (10 PDB entries)
  8. 2460189Domain d1gwba_: 1gwb A: [76362]
    complexed with acy, nag, pt, so4

Details for d1gwba_

PDB Entry: 1gwb (more details), 2.8 Å

PDB Description: structure of glycoprotein 1b
PDB Compounds: (A:) platelet glycoprotein ib alpha chain

SCOPe Domain Sequences for d1gwba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwba_ c.10.2.7 (A:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}
picevskvashlevncdkrnltalppdlpkdttilhlsenllytfslatlmpytrltqln
ldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgalr
glgelqelylkgnelktlppglltptpkleklslannnltelpagllnglenldtlllqe
nslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamts
nvasvqcdnsdkfpvykypgkgcptl

SCOPe Domain Coordinates for d1gwba_:

Click to download the PDB-style file with coordinates for d1gwba_.
(The format of our PDB-style files is described here.)

Timeline for d1gwba_: