SCOP 1.63: Domain d1gwba_: 1gwb A:

Lineage for d1gwba_ (1gwb A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N

4. Superfamily c.10.2: L domain-like [52058] (7 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.7: von Willebrand factor binding domain of glycoprotein Ib alpha [75142] (1 protein)
   this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain

6. Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75144] (3 PDB entries)

8. Domain d1gwba_: 1gwb A: [76362]

Details for d1gwba_

PDB Entry: 1gwb, 2.8 Å

PDB Description: structure of glycoprotein 1b

SCOP Domain Sequences for d1gwba_:

Sequence; same for both SEQRES and ATOM records:

>d1gwba_ c.10.2.7 (A:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens)}
picevskvashlevncdkrnltalppdlpkdttilhlsenllytfslatlmpytrltqln
ldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgalr
glgelqelylkgnelktlppglltptpkleklslannnltelpagllnglenldtlllqe
nslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamts
nvasvqcdnsdkfpvykypgkgcptl

Timeline for d1gwba_:

• d1gwba_ is new in SCOP 1.63
  
• d1gwba_ appears in SCOP 1.65
  
• d1gwba_ appears in the current release, SCOPe 2.08