Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Prostate specific antigen (PSA kallikrein) [82122] (1 species) |
Species Horse (Equus caballus) [TaxId:9796] [82123] (1 PDB entry) |
Domain d1gvza_: 1gvz A: [76360] complexed with act, gol |
PDB Entry: 1gvz (more details), 1.42 Å
SCOPe Domain Sequences for d1gvza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} iiggwecekhskpwqvavyhqghfqcggvlvhpqwvltaahcmsddyqiwlgrhnlskde dtaqfhqvsdsfldpqfdlsllkkkylrpyddishdlmllrlaqparitdavkildlptq epklgstcytsgwglistftnrgsgtlqcvelrlqsnekcaraypekmtefvlcathrdd sgsiclgdsggalicdgvfqgitswgysecadfndnfvftkvmphkkwiketiekns
Timeline for d1gvza_: