Lineage for d1gvza_ (1gvz A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405304Protein Prostate specific antigen (PSA kallikrein) [82122] (1 species)
  7. 2405305Species Horse (Equus caballus) [TaxId:9796] [82123] (1 PDB entry)
  8. 2405306Domain d1gvza_: 1gvz A: [76360]
    complexed with act, gol

Details for d1gvza_

PDB Entry: 1gvz (more details), 1.42 Å

PDB Description: prostate specific antigen (psa) from stallion seminal plasma
PDB Compounds: (A:) kallikrein-1e2

SCOPe Domain Sequences for d1gvza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]}
iiggwecekhskpwqvavyhqghfqcggvlvhpqwvltaahcmsddyqiwlgrhnlskde
dtaqfhqvsdsfldpqfdlsllkkkylrpyddishdlmllrlaqparitdavkildlptq
epklgstcytsgwglistftnrgsgtlqcvelrlqsnekcaraypekmtefvlcathrdd
sgsiclgdsggalicdgvfqgitswgysecadfndnfvftkvmphkkwiketiekns

SCOPe Domain Coordinates for d1gvza_:

Click to download the PDB-style file with coordinates for d1gvza_.
(The format of our PDB-style files is described here.)

Timeline for d1gvza_: