Lineage for d1gvqa_ (1gvq A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384012Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 384013Family c.1.4.1: FMN-linked oxidoreductases [51396] (15 proteins)
  6. 384151Protein Pentaerythritol tetranirate reductase [63900] (1 species)
  7. 384152Species Enterobacter cloacae [TaxId:550] [63901] (10 PDB entries)
  8. 384162Domain d1gvqa_: 1gvq A: [76358]
    complexed with cyh, fmn

Details for d1gvqa_

PDB Entry: 1gvq (more details), 2 Å

PDB Description: structure of pentaerythritol tetranitrate reductase and complexed with 2-cyclohexenone

SCOP Domain Sequences for d1gvqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvqa_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae}
eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis
aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsa
salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
vdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigaga
ytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyp
sl

SCOP Domain Coordinates for d1gvqa_:

Click to download the PDB-style file with coordinates for d1gvqa_.
(The format of our PDB-style files is described here.)

Timeline for d1gvqa_: