Lineage for d1gvnd_ (1gvn D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113807Family c.37.1.21: Plasmid maintenance system epsilon/zeta, toxin zeta subunit [82395] (2 protein domains)
    similar to the nucleotide/nucleoside kinases; extra N- and C-terminal structures
  6. 2113808Protein Plasmid maintenance system epsilon/zeta, toxin zeta subunit [82396] (1 species)
  7. 2113809Species Streptococcus pyogenes [TaxId:1314] [82397] (1 PDB entry)
  8. 2113811Domain d1gvnd_: 1gvn D: [76356]
    Other proteins in same PDB: d1gvna_, d1gvnc_
    complexed with so4

Details for d1gvnd_

PDB Entry: 1gvn (more details), 1.95 Å

PDB Description: crystal structure of the plasmid maintenance system epsilon/zeta: meachnism of toxin inactivation and toxin function
PDB Compounds: (D:) zeta

SCOPe Domain Sequences for d1gvnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvnd_ c.37.1.21 (D:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}
anivnftdkqfenrlndnleeliqgkkavesptafllggqpgsgktslrsaifeetqgnv
ividndtfkqqhpnfdelvklyekdvvkhvtpysnrmteaiisrlsdqgynlviegtgrt
tdvpiqtatmlqakgyetkmyvmavpkinsylgtieryetmyaddpmtaratpkqahdiv
vknlptnletlhktglfsdirlynregvklyssletpsispketlekelnrkvsgkeiqp
tlerieqkmvlnkhqetpefkaiqqkleslq

SCOPe Domain Coordinates for d1gvnd_:

Click to download the PDB-style file with coordinates for d1gvnd_.
(The format of our PDB-style files is described here.)

Timeline for d1gvnd_: