Lineage for d1guia_ (1gui A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662025Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 662026Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families) (S)
  5. 662352Family b.18.1.14: CBM4/9 [74893] (3 proteins)
  6. 662357Protein Carbohydrate binding module from laminarinase 16A [82018] (1 species)
  7. 662358Species Thermotoga maritima [TaxId:2336] [82019] (1 PDB entry)
  8. 662359Domain d1guia_: 1gui A: [76351]
    complexed with bgc, ca, gol

Details for d1guia_

PDB Entry: 1gui (more details), 1.9 Å

PDB Description: cbm4 structure and function
PDB Compounds: (A:) laminarinase 16a

SCOP Domain Sequences for d1guia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guia_ b.18.1.14 (A:) Carbohydrate binding module from laminarinase 16A {Thermotoga maritima [TaxId: 2336]}
sinngtfdepivndqannpdewfiwqagdygisgarvsdygvrdgyayitiadpgtdtwh
iqfnqwiglyrgktytisfkakadtprpinvkilqnhdpwtnyfaqtvnltadwqtftft
ythpddadevvqisfelgegtattiyfddvtvspq

SCOP Domain Coordinates for d1guia_:

Click to download the PDB-style file with coordinates for d1guia_.
(The format of our PDB-style files is described here.)

Timeline for d1guia_: