Lineage for d1gu3a_ (1gu3 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792799Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 792800Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) (S)
  5. 793163Family b.18.1.14: CBM4/9 [74893] (3 proteins)
  6. 793171Protein Cellulose-binding domain of cellulase C [49809] (1 species)
  7. 793172Species Cellulomonas fimi [TaxId:1708] [49810] (4 PDB entries)
  8. 793173Domain d1gu3a_: 1gu3 A: [76350]
    complex with cellopentaose
    complexed with bgc

Details for d1gu3a_

PDB Entry: 1gu3 (more details), 2.3 Å

PDB Description: cbm4 structure and function
PDB Compounds: (A:) endoglucanase c

SCOP Domain Sequences for d1gu3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gu3a_ b.18.1.14 (A:) Cellulose-binding domain of cellulase C {Cellulomonas fimi [TaxId: 1708]}
tfddgpegwvaygtdgpldtstgalcvavpagsaqygvgvvlngvaieegttytlrytat
astdvtvralvgqngapygtvldtspaltseprqvtetftasatypatpaaddpegqiaf
qlggfsadawtlclddvaldse

SCOP Domain Coordinates for d1gu3a_:

Click to download the PDB-style file with coordinates for d1gu3a_.
(The format of our PDB-style files is described here.)

Timeline for d1gu3a_: