SCOP 1.75: Domain d1gu3a_: 1gu3 A:

Lineage for d1gu3a_ (1gu3 A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families)

5. Family b.18.1.14: CBM4/9 [74893] (3 proteins)

6. Protein Cellulose-binding domain of cellulase C [49809] (1 species)

7. Species Cellulomonas fimi [TaxId:1708] [49810] (4 PDB entries)

8. Domain d1gu3a_: 1gu3 A: [76350]
   complex with cellopentaose
   complexed with bgc

Details for d1gu3a_

PDB Entry: 1gu3, 2.3 Å

PDB Description: cbm4 structure and function

PDB Compounds: (A:) endoglucanase c

SCOP Domain Sequences for d1gu3a_:

Sequence; same for both SEQRES and ATOM records:

>d1gu3a_ b.18.1.14 (A:) Cellulose-binding domain of cellulase C {Cellulomonas fimi [TaxId: 1708]}
tfddgpegwvaygtdgpldtstgalcvavpagsaqygvgvvlngvaieegttytlrytat
astdvtvralvgqngapygtvldtspaltseprqvtetftasatypatpaaddpegqiaf
qlggfsadawtlclddvaldse

Timeline for d1gu3a_:

• d1gu3a_ first appeared in SCOP 1.63
  
• d1gu3a_ appears in SCOP 1.73
  
• d1gu3a_ appears in SCOPe 2.01
  
• d1gu3a_ appears in the current release, SCOPe 2.08