SCOPe 2.05: Domain d1gu2a_: 1gu2 A:

Lineage for d1gu2a_ (1gu2 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c'' [68950] (1 species)
   close homologue of SHP

7. Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [68951] (3 PDB entries)

8. Domain d1gu2a_: 1gu2 A: [76348]
   complexed with hec

Details for d1gu2a_

PDB Entry: 1gu2, 1.19 Å

PDB Description: crystal structure of oxidized cytochrome c'' from methylophilus methylotrophus

PDB Compounds: (A:) cytochrome c''

SCOPe Domain Sequences for d1gu2a_:

Sequence; same for both SEQRES and ATOM records:

>d1gu2a_ a.3.1.1 (A:) Cytochrome c'' {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
dvtnaeklvykytniahsanpmyeapsitdgkiffnrkfktpsgkeaacaschtnnpanv
gknivtgkeipplaprvntkrftdidkvedeftkhcndilgadcspsekanfiaylltet
kptk

Timeline for d1gu2a_:

• d1gu2a_ first appeared in SCOP 1.63
  
• d1gu2a_ appears in SCOPe 2.04
  
• d1gu2a_ appears in SCOPe 2.06
  
• d1gu2a_ appears in the current release, SCOPe 2.08