Lineage for d1gu2a_ (1gu2 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 209876Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)
  6. 209877Protein Cytochrome c'' [68950] (1 species)
    close homologue of SHP
  7. 209878Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [68951] (2 PDB entries)
  8. 209879Domain d1gu2a_: 1gu2 A: [76348]

Details for d1gu2a_

PDB Entry: 1gu2 (more details), 1.19 Å

PDB Description: crystal structure of oxidized cytochrome c'' from methylophilus methylotrophus
PDB Compounds: (A:)

SCOP Domain Sequences for d1gu2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gu2a_ a.3.1.1 (A:) Cytochrome c'' {Methylophilus methylotrophus, strain w3a1}
dvtnaeklvykytniahsanpmyeapsitdgkiffnrkfktpsgkeaacaschtnnpanv
gknivtgkeipplaprvntkrftdidkvedeftkhcndilgadcspsekanfiaylltet
kptk

SCOP Domain Coordinates for d1gu2a_:

Click to download the PDB-style file with coordinates for d1gu2a_.
(The format of our PDB-style files is described here.)

Timeline for d1gu2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gu2b_