Lineage for d1gtka2 (1gtk A:220-313)
- Root: SCOP 1.63
Class d: Alpha and beta proteins (a+b) [53931] (224 folds) 
Fold d.50: dsRBD-like [54767] (3 superfamilies)
alpha-beta(3)-alpha; 2 layers: alpha/betaSuperfamily d.50.2: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54782] (1 family) 
Family d.50.2.1: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54783] (1 protein) Protein Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54784] (1 species) Species Escherichia coli [TaxId:562] [54785] (5 PDB entries) 
Domain d1gtka2: 1gtk A:220-313 [76347]
Other proteins in same PDB: d1gtka1
complexed with dpm
Details for d1gtka2
PDB Entry: 1gtk (more details), 1.66 Å
PDB Description: time-resolved and static-ensemble structural chemistry of hydroxymethylbilane synthase
SCOP Domain Sequences for d1gtka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtka2 d.50.2.1 (A:220-313) Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain {Escherichia coli}
nhhetalrvtaeramntrleggcqvpigsyaelidgeiwlralvgapdgsqiirgerrga
pqdaeqmgislaeellnngareilaevyngdapa
SCOP Domain Coordinates for d1gtka2:
Click to download the PDB-style file with coordinates for d1gtka2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gtka2:
- d1gtka2 is new in SCOP 1.63
- d1gtka2 appears in SCOP 1.65
- d1gtka2 appears in the current release, SCOPe 2.08
View in 3D
